SCOP 1.57: Domain d1hjbe_: 1hjb E:

Lineage for d1hjbe_ (1hjb E:)

1. Root: SCOP 1.57
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (20 superfamilies)
4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)
5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
6. Protein C/ebp beta [57985] (2 species)
7. Species Human (Homo sapiens) [TaxId:9606] [64590] (2 PDB entries)
8. Domain d1hjbe_: 1hjb E: [61077]
   Other proteins in same PDB: d1hjbc_, d1hjbf_

Details for d1hjbe_

PDB Entry: 1hjb, 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjbe_:

Sequence; same for both SEQRES and ATOM records:

>d1hjbe_ h.1.3.1 (E:) C/ebp beta {Human (Homo sapiens)}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkqlp

SCOP Domain Coordinates for d1hjbe_ are not available.

Timeline for d1hjbe_:

• d1hjbe_ is new in SCOP 1.57
  
• d1hjbe_ appears in SCOP 1.59
  
• d1hjbe_ appears in the current release, SCOPe 2.08