Lineage for d1hjbf_ (1hjb F:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55415Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 55416Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 55417Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
  7. 55429Species Mouse (Mus musculus) [TaxId:10090] [63684] (3 PDB entries)
  8. 55433Domain d1hjbf_: 1hjb F: [61078]
    Other proteins in same PDB: d1hjba_, d1hjbb_, d1hjbd_, d1hjbe_

Details for d1hjbf_

PDB Entry: 1hjb (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjbf_ b.2.5.1 (F:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpreprrh

SCOP Domain Coordinates for d1hjbf_:

Click to download the PDB-style file with coordinates for d1hjbf_.
(The format of our PDB-style files is described here.)

Timeline for d1hjbf_: