![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (2 families) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
![]() | Protein C/ebp beta [57985] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries) |
![]() | Domain d1hjba_: 1hjb A: [61073] Other proteins in same PDB: d1hjbc_, d1hjbf_ homodimer protein/DNA complex |
PDB Entry: 1hjb (more details), 3 Å
SCOPe Domain Sequences for d1hjba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjba_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]} dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl rnlfkq
Timeline for d1hjba_: