SCOPe 2.08: Domain d1hbmb1: 1hbm B:189-443

Lineage for d1hbmb1 (1hbm B:189-443)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [48087] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)

8. Domain d1hbmb1: 1hbm B:189-443 [60890]
   Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb2, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme2, d1hbmf_
   complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbmb1

PDB Entry: 1hbm, 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex

PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbmb1:

Sequence; same for both SEQRES and ATOM records:

>d1hbmb1 a.89.1.1 (B:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

Timeline for d1hbmb1:

• d1hbmb1 first appeared in SCOP 1.57
  
• d1hbmb1 appears in SCOPe 2.07