Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries) |
Domain d1hbmf_: 1hbm F: [60897] Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmb2, d1hbmd1, d1hbmd2, d1hbme1, d1hbme2 complexed with cl, f43, gol, mg, na, sht, zn |
PDB Entry: 1hbm (more details), 1.8 Å
SCOPe Domain Sequences for d1hbmf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbmf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr sqggfnl
Timeline for d1hbmf_: