Lineage for d1hbmf_ (1hbm F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955027Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2955028Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2955029Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries)
  8. 2955053Domain d1hbmf_: 1hbm F: [60897]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmb2, d1hbmd1, d1hbmd2, d1hbme1, d1hbme2
    complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbmf_

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex
PDB Compounds: (F:) methyl-coenzyme m reductase I gamma subunit

SCOPe Domain Sequences for d1hbmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbmf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOPe Domain Coordinates for d1hbmf_:

Click to download the PDB-style file with coordinates for d1hbmf_.
(The format of our PDB-style files is described here.)

Timeline for d1hbmf_: