Lineage for d1hbme1 (1hbm E:189-443)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719657Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2719688Protein Beta chain [48087] (3 species)
  7. 2719689Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 2719707Domain d1hbme1: 1hbm E:189-443 [60895]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb2, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme2, d1hbmf_
    complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbme1

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex
PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbme1 a.89.1.1 (E:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d1hbme1:

Click to download the PDB-style file with coordinates for d1hbme1.
(The format of our PDB-style files is described here.)

Timeline for d1hbme1: