Lineage for d1hbme2 (1hbm E:2-188)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955084Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2955115Protein Beta chain [55099] (3 species)
  7. 2955116Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)
  8. 2955134Domain d1hbme2: 1hbm E:2-188 [60896]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme1, d1hbmf_
    complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbme2

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex
PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbme2 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d1hbme2:

Click to download the PDB-style file with coordinates for d1hbme2.
(The format of our PDB-style files is described here.)

Timeline for d1hbme2: