SCOPe 2.08: Domain d1hbme2: 1hbm E:2-188

Lineage for d1hbme2 (1hbm E:2-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [55099] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)

8. Domain d1hbme2: 1hbm E:2-188 [60896]
   Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme1, d1hbmf_
   complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbme2

PDB Entry: 1hbm, 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex

PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbme2:

Sequence; same for both SEQRES and ATOM records:

>d1hbme2 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d1hbme2:

• d1hbme2 first appeared in SCOP 1.57
  
• d1hbme2 appears in SCOPe 2.07