Lineage for d1h4td1 (1h4t D:277-403)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71421Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 71422Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 71423Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 protein domains)
  6. 71424Protein C-terminal domain of ProRS [64071] (1 species)
  7. 71425Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)
  8. 71435Domain d1h4td1: 1h4t D:277-403 [60619]
    Other proteins in same PDB: d1h4ta2, d1h4ta3, d1h4tb2, d1h4tb3, d1h4tc2, d1h4tc3, d1h4td2, d1h4td3

Details for d1h4td1

PDB Entry: 1h4t (more details), 2.9 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with l-proline

SCOP Domain Sequences for d1h4td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4td1 c.51.1.1 (D:277-403) C-terminal domain of ProRS {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

SCOP Domain Coordinates for d1h4td1:

Click to download the PDB-style file with coordinates for d1h4td1.
(The format of our PDB-style files is described here.)

Timeline for d1h4td1: