Lineage for d1h4td1 (1h4t D:277-403)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2881871Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2881872Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2881918Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)
  7. 2881929Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)
  8. 2881937Domain d1h4td1: 1h4t D:277-403 [60619]
    Other proteins in same PDB: d1h4ta2, d1h4ta3, d1h4tb2, d1h4tb3, d1h4tc2, d1h4tc3, d1h4td2, d1h4td3
    protein/RNA complex; complexed with pro, zn

Details for d1h4td1

PDB Entry: 1h4t (more details), 2.9 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with l-proline
PDB Compounds: (D:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4td1 c.51.1.1 (D:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

SCOPe Domain Coordinates for d1h4td1:

Click to download the PDB-style file with coordinates for d1h4td1.
(The format of our PDB-style files is described here.)

Timeline for d1h4td1: