Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) contains a metal (zinc)-binding site |
Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein) |
Protein C-terminal domain of ProRS [64588] (3 species) |
Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries) |
Domain d1h4td3: 1h4t D:404-477 [60621] Other proteins in same PDB: d1h4ta1, d1h4ta2, d1h4tb1, d1h4tb2, d1h4tc1, d1h4tc2, d1h4td1, d1h4td2 protein/RNA complex; complexed with pro, zn |
PDB Entry: 1h4t (more details), 2.9 Å
SCOPe Domain Sequences for d1h4td3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4td3 d.68.5.1 (D:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]} trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr psaygkrvvfakay
Timeline for d1h4td3: