Lineage for d1h4tb3 (1h4t B:404-477)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90921Fold g.56: C-terminal domain of ProRS [64585] (1 superfamily)
  4. 90922Superfamily g.56.1: C-terminal domain of ProRS [64586] (1 family) (S)
  5. 90923Family g.56.1.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 90924Protein C-terminal domain of ProRS [64588] (1 species)
  7. 90925Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 90933Domain d1h4tb3: 1h4t B:404-477 [60615]
    Other proteins in same PDB: d1h4ta1, d1h4ta2, d1h4tb1, d1h4tb2, d1h4tc1, d1h4tc2, d1h4td1, d1h4td2

Details for d1h4tb3

PDB Entry: 1h4t (more details), 2.9 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with l-proline

SCOP Domain Sequences for d1h4tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4tb3 g.56.1.1 (B:404-477) C-terminal domain of ProRS {Thermus thermophilus}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOP Domain Coordinates for d1h4tb3:

Click to download the PDB-style file with coordinates for d1h4tb3.
(The format of our PDB-style files is described here.)

Timeline for d1h4tb3: