SCOP 1.57: Domain d1h4tc1: 1h4t C:277-403

Lineage for d1h4tc1 (1h4t C:277-403)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein C-terminal domain of ProRS [64071] (1 species)

7. Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)

8. Domain d1h4tc1: 1h4t C:277-403 [60616]
   Other proteins in same PDB: d1h4ta2, d1h4ta3, d1h4tb2, d1h4tb3, d1h4tc2, d1h4tc3, d1h4td2, d1h4td3

Details for d1h4tc1

PDB Entry: 1h4t, 2.9 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with l-proline

SCOP Domain Sequences for d1h4tc1:

Sequence; same for both SEQRES and ATOM records:

>d1h4tc1 c.51.1.1 (C:277-403) C-terminal domain of ProRS {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

Timeline for d1h4tc1:

• d1h4tc1 is new in SCOP 1.57
  
• d1h4tc1 appears in SCOP 1.59
  
• d1h4tc1 appears in the current release, SCOPe 2.08