Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) |
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) |
Protein C-terminal domain of ProRS [64071] (1 species) |
Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries) |
Domain d1h4tb1: 1h4t B:277-403 [60613] Other proteins in same PDB: d1h4ta2, d1h4ta3, d1h4tb2, d1h4tb3, d1h4tc2, d1h4tc3, d1h4td2, d1h4td3 |
PDB Entry: 1h4t (more details), 2.9 Å
SCOP Domain Sequences for d1h4tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4tb1 c.51.1.1 (B:277-403) C-terminal domain of ProRS {Thermus thermophilus} rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra lafredh
Timeline for d1h4tb1: