![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Diaminopimelic acid dehydrogenase (DAPDH) [51819] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [51820] (4 PDB entries) |
![]() | Domain d1f06b1: 1f06 B:501-618,B:769-820 [59558] Other proteins in same PDB: d1f06a2, d1f06b2 complexed with 2np, ndp |
PDB Entry: 1f06 (more details), 2.1 Å
SCOPe Domain Sequences for d1f06b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f06b1 c.2.1.3 (B:501-618,B:769-820) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgXr npdftassqiafgraahrmkqqgqsgaftvlevapyllspenlddliardv
Timeline for d1f06b1: