PDB entry 1f06

View 1f06 on RCSB PDB site
Description: three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase nadph-l-2-amino-6-methylene-pimelate
Class: oxidoreductase
Keywords: Enzyme-NADPH-inhibitor ternary complex, OXIDOREDUCTASE
Deposited on 2000-05-14, released 2001-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: meso-diaminopimelate d-dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f06a1, d1f06a2
  • Chain 'B':
    Compound: meso-diaminopimelate d-dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f06b1, d1f06b2
  • Heterogens: NDP, 2NP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f06A (A:)
    mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
    vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwd
    pgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalekar
    rgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdseht
    gmphgghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvl
    evapyllspenlddliardv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f06B (B:)
    mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
    vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwd
    pgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalekar
    rgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdseht
    gmphgghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvl
    evapyllspenlddliardv