Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species) distantly related to dihydrodipicolinate reductase larger alpha+beta subdomain substitutes for one helix and one strand of the common fold |
Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries) |
Domain d1f06b2: 1f06 B:619-768 [59559] Other proteins in same PDB: d1f06a1, d1f06b1 complexed with 2np, ndp has additional subdomain(s) that are not in the common domain |
PDB Entry: 1f06 (more details), 2.1 Å
SCOPe Domain Sequences for d1f06b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f06b2 d.81.1.3 (B:619-768) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse htgmphgghvittgdtggfnhtveyilkld
Timeline for d1f06b2: