Lineage for d1f06b2 (1f06 B:619-768)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962045Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
    distantly related to dihydrodipicolinate reductase
    larger alpha+beta subdomain substitutes for one helix and one strand of the common fold
  7. 2962046Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)
  8. 2962053Domain d1f06b2: 1f06 B:619-768 [59559]
    Other proteins in same PDB: d1f06a1, d1f06b1
    complexed with 2np, ndp
    has additional subdomain(s) that are not in the common domain

Details for d1f06b2

PDB Entry: 1f06 (more details), 2.1 Å

PDB Description: three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase nadph-l-2-amino-6-methylene- pimelate
PDB Compounds: (B:) meso-diaminopimelate d-dehydrogenase

SCOPe Domain Sequences for d1f06b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f06b2 d.81.1.3 (B:619-768) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

SCOPe Domain Coordinates for d1f06b2:

Click to download the PDB-style file with coordinates for d1f06b2.
(The format of our PDB-style files is described here.)

Timeline for d1f06b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f06b1