Lineage for d1f06b2 (1f06 B:619-768)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81742Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (2 proteins)
  6. 81743Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
  7. 81744Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)
  8. 81746Domain d1f06b2: 1f06 B:619-768 [59559]
    Other proteins in same PDB: d1f06a1, d1f06b1

Details for d1f06b2

PDB Entry: 1f06 (more details), 2.1 Å

PDB Description: three dimensional structure of the ternary complex of corynebacterium glutamicum diaminopimelate dehydrogenase nadph-l-2-amino-6-methylene- pimelate

SCOP Domain Sequences for d1f06b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f06b2 d.81.1.3 (B:619-768) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

SCOP Domain Coordinates for d1f06b2:

Click to download the PDB-style file with coordinates for d1f06b2.
(The format of our PDB-style files is described here.)

Timeline for d1f06b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f06b1