SCOPe 2.08: Domain d1eu8a_: 1eu8 A:

Lineage for d1eu8a_ (1eu8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Thermococcus litoralis [TaxId:2265] [64191] (1 PDB entry)
   trehalose maltose-binding protein

8. Domain d1eu8a_: 1eu8 A: [59502]
   complexed with cl, pt
   has additional insertions and/or extensions that are not grouped together

Details for d1eu8a_

PDB Entry: 1eu8, 1.9 Å

PDB Description: structure of trehalose maltose binding protein from thermococcus litoralis

PDB Compounds: (A:) trehalose/maltose binding protein

SCOPe Domain Sequences for d1eu8a_:

Sequence; same for both SEQRES and ATOM records:

>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Thermococcus litoralis [TaxId: 2265]}
ieegkivfavggapneieywkgviaefekkypgvtvelkrqatdteqrrldlvnalrgks
sdpdvflmdvawlgqfiasgwleplddyvqkdnydlsvffqsvinladkqggklyalpvy
idagllyyrkdllekygyskppetwqelvemaqkiqsgeretnpnfwgfvwqgkqyeglv
cdfveyvysnggslgefkdgkwvptlnkpenvealqfmvdlihkykisppntytemteep
vrlmfqqgnaafernwpyawglhnaddspvkgkvgvaplphfpghksaatlggwhigisk
ysdnkalawefvkfvesysvqkgfamnlgwnpgrvdvyddpavvsksphlkelravfena
vprpivpyypqlseiiqkyvnsalagkispqealdkaqkeaeelvkq

Timeline for d1eu8a_:

• d1eu8a_ first appeared in SCOP 1.57
  
• d1eu8a_ appears in SCOPe 2.07