Lineage for d1eu8a_ (1eu8 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (17 proteins) 
Protein D-maltodextrin-binding protein, MBP [53862] (3 species) 
Species Archaeon Thermococcus litoralis [TaxId:2265] [64191] (1 PDB entry) 
Domain d1eu8a_: 1eu8 A: [59502]
Details for d1eu8a_
PDB Entry: 1eu8 (more details), 1.9 Å
PDB Description: structure of trehalose maltose binding protein from thermococcus litoralis
SCOP Domain Sequences for d1eu8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis}
ieegkivfavggapneieywkgviaefekkypgvtvelkrqatdteqrrldlvnalrgks
sdpdvflmdvawlgqfiasgwleplddyvqkdnydlsvffqsvinladkqggklyalpvy
idagllyyrkdllekygyskppetwqelvemaqkiqsgeretnpnfwgfvwqgkqyeglv
cdfveyvysnggslgefkdgkwvptlnkpenvealqfmvdlihkykisppntytemteep
vrlmfqqgnaafernwpyawglhnaddspvkgkvgvaplphfpghksaatlggwhigisk
ysdnkalawefvkfvesysvqkgfamnlgwnpgrvdvyddpavvsksphlkelravfena
vprpivpyypqlseiiqkyvnsalagkispqealdkaqkeaeelvkq
SCOP Domain Coordinates for d1eu8a_:
Click to download the PDB-style file with coordinates for d1eu8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eu8a_:
- d1eu8a_ is new in SCOP 1.57
- d1eu8a_ appears in SCOP 1.59
- d1eu8a_ appears in the current release, SCOPe 2.08
View in 3D