PDB entry 1eu8

View 1eu8 on RCSB PDB site
Description: structure of trehalose maltose binding protein from thermococcus litoralis
Class: sugar binding protein
Keywords: trehalose-maltose binding protein, protein-carbohydrate complex, mbp 2 fold, abc transporter fold, thermophilic protein, sugar binding protein
Deposited on 2000-04-14, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trehalose/maltose binding protein
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O51923 (0-End)
      • conflict (0-2)
    Domains in SCOPe 2.07: d1eu8a_
  • Heterogens: PT, CL, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eu8A (A:)
    ieegkivfavggapneieywkgviaefekkypgvtvelkrqatdteqrrldlvnalrgks
    sdpdvflmdvawlgqfiasgwleplddyvqkdnydlsvffqsvinladkqggklyalpvy
    idagllyyrkdllekygyskppetwqelvemaqkiqsgeretnpnfwgfvwqgkqyeglv
    cdfveyvysnggslgefkdgkwvptlnkpenvealqfmvdlihkykisppntytemteep
    vrlmfqqgnaafernwpyawglhnaddspvkgkvgvaplphfpghksaatlggwhigisk
    ysdnkalawefvkfvesysvqkgfamnlgwnpgrvdvyddpavvsksphlkelravfena
    vprpivpyypqlseiiqkyvnsalagkispqealdkaqkeaeelvkqys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eu8A (A:)
    ieegkivfavggapneieywkgviaefekkypgvtvelkrqatdteqrrldlvnalrgks
    sdpdvflmdvawlgqfiasgwleplddyvqkdnydlsvffqsvinladkqggklyalpvy
    idagllyyrkdllekygyskppetwqelvemaqkiqsgeretnpnfwgfvwqgkqyeglv
    cdfveyvysnggslgefkdgkwvptlnkpenvealqfmvdlihkykisppntytemteep
    vrlmfqqgnaafernwpyawglhnaddspvkgkvgvaplphfpghksaatlggwhigisk
    ysdnkalawefvkfvesysvqkgfamnlgwnpgrvdvyddpavvsksphlkelravfena
    vprpivpyypqlseiiqkyvnsalagkispqealdkaqkeaeelvkq