Lineage for d1eoic_ (1eoi C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006109Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein)
  6. 2006110Protein Bacterial acid phosphatase [48319] (1 species)
  7. 2006111Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries)
  8. 2006115Domain d1eoic_: 1eoi C: [59483]
    complexed with moo

Details for d1eoic_

PDB Entry: 1eoi (more details), 2.4 Å

PDB Description: crystal structure of acid phosphatase from escherichia blattae complexed with the transition state analog molybdate
PDB Compounds: (C:) acid phosphatase

SCOPe Domain Sequences for d1eoic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoic_ a.111.1.1 (C:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh

SCOPe Domain Coordinates for d1eoic_:

Click to download the PDB-style file with coordinates for d1eoic_.
(The format of our PDB-style files is described here.)

Timeline for d1eoic_: