Lineage for d1eoic_ (1eoi C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50375Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
  4. 50376Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (3 families) (S)
  5. 50377Family a.111.1.1: Acid phosphatase [48318] (1 protein)
  6. 50378Protein Acid phosphatase [48319] (1 species)
  7. 50379Species Escherichia blattae [TaxId:563] [48320] (2 PDB entries)
  8. 50383Domain d1eoic_: 1eoi C: [59483]

Details for d1eoic_

PDB Entry: 1eoi (more details), 2.4 Å

PDB Description: crystal structure of acid phosphatase from escherichia blattae complexed with the transition state analog molybdate

SCOP Domain Sequences for d1eoic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoic_ a.111.1.1 (C:) Acid phosphatase {Escherichia blattae}
gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh

SCOP Domain Coordinates for d1eoic_:

Click to download the PDB-style file with coordinates for d1eoic_.
(The format of our PDB-style files is described here.)

Timeline for d1eoic_: