Class a: All alpha proteins [46456] (290 folds) |
Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily) multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix |
Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) |
Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein) |
Protein Bacterial acid phosphatase [48319] (1 species) |
Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries) |
Domain d1eoib_: 1eoi B: [59482] complexed with moo |
PDB Entry: 1eoi (more details), 2.4 Å
SCOPe Domain Sequences for d1eoib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eoib_ a.111.1.1 (B:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]} gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh
Timeline for d1eoib_: