Lineage for d1eoib_ (1eoi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725079Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2725080Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2725081Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein)
  6. 2725082Protein Bacterial acid phosphatase [48319] (1 species)
  7. 2725083Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries)
  8. 2725092Domain d1eoib_: 1eoi B: [59482]
    complexed with moo

Details for d1eoib_

PDB Entry: 1eoi (more details), 2.4 Å

PDB Description: crystal structure of acid phosphatase from escherichia blattae complexed with the transition state analog molybdate
PDB Compounds: (B:) acid phosphatase

SCOPe Domain Sequences for d1eoib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoib_ a.111.1.1 (B:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh

SCOPe Domain Coordinates for d1eoib_:

Click to download the PDB-style file with coordinates for d1eoib_.
(The format of our PDB-style files is described here.)

Timeline for d1eoib_: