PDB entry 1eoi

View 1eoi on RCSB PDB site
Description: crystal structure of acid phosphatase from escherichia blattae complexed with the transition state analog molybdate
Class: hydrolase
Keywords: all-alpha, HYDROLASE
Deposited on 2000-03-23, released 2001-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eoia_
  • Chain 'B':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eoib_
  • Chain 'C':
    Compound: acid phosphatase
    Species: Escherichia blattae [TaxId:563]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eoic_
  • Heterogens: MOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eoiA (A:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eoiA (A:)
    gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
    danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
    ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
    gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eoiB (B:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eoiB (B:)
    gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
    danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
    ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
    gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eoiC (C:)
    lalvatgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrnter
    gklaaedanlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymr
    irpfafygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelg
    qsrvicgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eoiC (C:)
    gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
    danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
    ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
    gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh