SCOPe 2.07: Domain d1eoib_: 1eoi B:

Lineage for d1eoib_ (1eoi B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
   multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix

4. Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families)

5. Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein)

6. Protein Bacterial acid phosphatase [48319] (1 species)

7. Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries)

8. Domain d1eoib_: 1eoi B: [59482]
   complexed with moo

Details for d1eoib_

PDB Entry: 1eoi, 2.4 Å

PDB Description: crystal structure of acid phosphatase from escherichia blattae complexed with the transition state analog molybdate

PDB Compounds: (B:) acid phosphatase

SCOPe Domain Sequences for d1eoib_:

Sequence; same for both SEQRES and ATOM records:

>d1eoib_ a.111.1.1 (B:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic
gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqh

Timeline for d1eoib_:

• d1eoib_ first appeared in SCOP 1.57
  
• d1eoib_ appears in SCOPe 2.06
  
• d1eoib_ appears in the current release, SCOPe 2.08