Lineage for d1sfcl_ (1sfc L:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969135Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 1969136Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 1969166Protein Synaptosomal-associated protein SNAP-25 [88915] (3 species)
    provides up to two different helical regions to synaptic fusion complexes
  7. 1969179Species Norway rat (Rattus norvegicus) [TaxId:10116] [88916] (4 PDB entries)
    Uniprot P13795 7-83; 142-204 # identical sequences to human species
  8. 1969191Domain d1sfcl_: 1sfc L: [45654]
    Other proteins in same PDB: d1sfca_, d1sfcb_, d1sfce_, d1sfcf_, d1sfci_, d1sfcj_
    complex with synaptobrevin and syntaxin fragments
    complexed with mpd, sr

Details for d1sfcl_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex
PDB Compounds: (L:) protein (snap-25b)

SCOPe Domain Sequences for d1sfcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfcl_ h.1.15.1 (L:) Synaptosomal-associated protein SNAP-25 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr
ideanqratkmlg

SCOPe Domain Coordinates for d1sfcl_:

Click to download the PDB-style file with coordinates for d1sfcl_.
(The format of our PDB-style files is described here.)

Timeline for d1sfcl_: