| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
| Protein Synaptosomal-associated protein SNAP-25 [88915] (3 species) provides up to two different helical regions to synaptic fusion complexes |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88916] (4 PDB entries) Uniprot P13795 7-83; 142-204 # identical sequences to human species |
| Domain d1sfcl_: 1sfc L: [45654] Other proteins in same PDB: d1sfca_, d1sfcb_, d1sfce_, d1sfcf_, d1sfci_, d1sfcj_ complex with synaptobrevin and syntaxin fragments complexed with mpd, sr |
PDB Entry: 1sfc (more details), 2.4 Å
SCOPe Domain Sequences for d1sfcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfcl_ h.1.15.1 (L:) Synaptosomal-associated protein SNAP-25 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr
ideanqratkmlg
Timeline for d1sfcl_: