SCOP 1.55: Domain d1sfcl_: 1sfc L:

Lineage for d1sfcl_ (1sfc L:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
4. Superfamily h.1.15: Neuronal synaptic fusion complex [58038] (1 family)
5. Family h.1.15.1: Neuronal synaptic fusion complex [58039] (1 protein)
6. Protein Neuronal synaptic fusion complex [58040] (1 species)
7. Species Rat (Rattus norvegicus) [TaxId:10116] [58041] (2 PDB entries)
8. Domain d1sfcl_: 1sfc L: [45654]

Details for d1sfcl_

PDB Entry: 1sfc, 2.4 Å

PDB Description: neuronal synaptic fusion complex

SCOP Domain Sequences for d1sfcl_:

Sequence; same for both SEQRES and ATOM records:

>d1sfcl_ h.1.15.1 (L:) Neuronal synaptic fusion complex {Rat (Rattus norvegicus)}
gfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktr
ideanqratkmlg

SCOP Domain Coordinates for d1sfcl_ are not available.

Timeline for d1sfcl_:

• d1sfcl_ appears in SCOP 1.57
  
• d1sfcl_ appears in the current release, SCOPe 2.08