Lineage for d1sfcj_ (1sfc J:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969135Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 1969136Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 1969192Protein Syntaxin 1A [88908] (3 species)
  7. 1969199Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    Uniprot P32851 196-259
    a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B
  8. 1969211Domain d1sfcj_: 1sfc J: [45652]
    Other proteins in same PDB: d1sfca_, d1sfcc_, d1sfcd_, d1sfce_, d1sfcg_, d1sfch_, d1sfci_, d1sfck_, d1sfcl_
    complex with synaptobrevin and SNAP-25 fragments
    complexed with mpd, sr

Details for d1sfcj_

PDB Entry: 1sfc (more details), 2.4 Å

PDB Description: neuronal synaptic fusion complex
PDB Compounds: (J:) protein (syntaxin 1a)

SCOPe Domain Sequences for d1sfcj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfcj_ h.1.15.1 (J:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
siskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyve
ravsdtkkavkyqs

SCOPe Domain Coordinates for d1sfcj_:

Click to download the PDB-style file with coordinates for d1sfcj_.
(The format of our PDB-style files is described here.)

Timeline for d1sfcj_: