Lineage for d1g25a_ (1g25 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41734Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
  4. 41735Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 41736Family g.44.1.1: RING finger domain, C3HC4 [57851] (5 proteins)
  6. 41746Protein TFIIH Mat1 subunit [57860] (1 species)
  7. 41747Species Human (Homo sapiens) [TaxId:9606] [57861] (1 PDB entry)
  8. 41748Domain d1g25a_: 1g25 A: [45325]

Details for d1g25a_

PDB Entry: 1g25 (more details)

PDB Description: solution structure of the n-terminal domain of the human tfiih mat1 subunit

SCOP Domain Sequences for d1g25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens)}
mddqgcprckttkyrnpslklmvnvcghtlcescvdllfvrgagncpecgtplrksnfrv
qlfed

SCOP Domain Coordinates for d1g25a_:

Click to download the PDB-style file with coordinates for d1g25a_.
(The format of our PDB-style files is described here.)

Timeline for d1g25a_: