PDB entry 1g25

View 1g25 on RCSB PDB site
Description: solution structure of the n-terminal domain of the human tfiih mat1 subunit
Deposited on 2000-10-17, released 2000-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g25a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g25A (A:)
    mddqgcprckttkyrnpslklmvnvcghtlcescvdllfvrgagncpecgtplrksnfrv
    qlfed