Lineage for d1fre__ (1fre -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41728Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
  4. 41729Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) (S)
  5. 41730Family g.43.1.1: B-box zinc-binding domain [57846] (1 protein)
  6. 41731Protein Nuclear factor XNF7 [57847] (1 species)
  7. 41732Species African clawed frog (Xenopus laevis) [TaxId:8355] [57848] (1 PDB entry)
  8. 41733Domain d1fre__: 1fre - [45320]

Details for d1fre__

PDB Entry: 1fre (more details)

PDB Description: xnf7 bbox, developmental protein, ph 7.5, 30 c, with zinc, nmr, 1 structure

SCOP Domain Sequences for d1fre__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fre__ g.43.1.1 (-) Nuclear factor XNF7 {African clawed frog (Xenopus laevis)}
ekcsehderlklyckddgtlscvicrdslkhashnflpi

SCOP Domain Coordinates for d1fre__:

Click to download the PDB-style file with coordinates for d1fre__.
(The format of our PDB-style files is described here.)

Timeline for d1fre__: