Lineage for d1frea_ (1fre A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037487Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 3037488Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 3037489Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 3037496Protein Nuclear factor XNF7 [57847] (1 species)
  7. 3037497Species African clawed frog (Xenopus laevis) [TaxId:8355] [57848] (1 PDB entry)
  8. 3037498Domain d1frea_: 1fre A: [45320]
    complexed with zn

Details for d1frea_

PDB Entry: 1fre (more details)

PDB Description: xnf7 bbox, developmental protein, ph 7.5, 30 c, with zinc, nmr, 1 structure
PDB Compounds: (A:) nuclear factor xnf7

SCOPe Domain Sequences for d1frea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ekcsehderlklyckddgtlscvicrdslkhashnflpi

SCOPe Domain Coordinates for d1frea_:

Click to download the PDB-style file with coordinates for d1frea_.
(The format of our PDB-style files is described here.)

Timeline for d1frea_: