Lineage for d1f1bb2 (1f1b B:101-153)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 145033Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 145034Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 145035Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 145036Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)
  8. 145039Domain d1f1bb2: 1f1b B:101-153 [45269]
    Other proteins in same PDB: d1f1ba1, d1f1ba2, d1f1bb1, d1f1bc1, d1f1bc2, d1f1bd1

Details for d1f1bb2

PDB Entry: 1f1b (more details), 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

SCOP Domain Sequences for d1f1bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1bb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1f1bb2:

Click to download the PDB-style file with coordinates for d1f1bb2.
(The format of our PDB-style files is described here.)

Timeline for d1f1bb2: