Lineage for d1f1bc1 (1f1b C:1-150)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127168Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 127169Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 127170Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 127171Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 127179Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 127198Domain d1f1bc1: 1f1b C:1-150 [35106]
    Other proteins in same PDB: d1f1bb1, d1f1bb2, d1f1bd1, d1f1bd2

Details for d1f1bc1

PDB Entry: 1f1b (more details), 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

SCOP Domain Sequences for d1f1bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1bc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1f1bc1:

Click to download the PDB-style file with coordinates for d1f1bc1.
(The format of our PDB-style files is described here.)

Timeline for d1f1bc1: