Lineage for d1f1bb1 (1f1b B:1-100)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133437Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 133438Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 133439Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 133440Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
  8. 133443Domain d1f1bb1: 1f1b B:1-100 [39017]
    Other proteins in same PDB: d1f1ba1, d1f1ba2, d1f1bb2, d1f1bc1, d1f1bc2, d1f1bd2

Details for d1f1bb1

PDB Entry: 1f1b (more details), 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

SCOP Domain Sequences for d1f1bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1bb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1f1bb1:

Click to download the PDB-style file with coordinates for d1f1bb1.
(The format of our PDB-style files is described here.)

Timeline for d1f1bb1: