SCOPe 2.08: Domain d1f1bb2: 1f1b B:101-153

Lineage for d1f1bb2 (1f1b B:101-153)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
   Uniprot P00478

8. Domain d1f1bb2: 1f1b B:101-153 [45269]
   Other proteins in same PDB: d1f1ba1, d1f1ba2, d1f1bb1, d1f1bc1, d1f1bc2, d1f1bd1
   complexed with pal, zn; mutant

Details for d1f1bb2

PDB Entry: 1f1b, 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1f1bb2:

Sequence; same for both SEQRES and ATOM records:

>d1f1bb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1f1bb2:

• d1f1bb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f1bb2 appears in SCOPe 2.07