Lineage for d1f1ba1 (1f1b A:1-150)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. Domain d1f1ba1: 1f1b A:1-150 [35104]
    Other proteins in same PDB: d1f1bb1, d1f1bb2, d1f1bd1, d1f1bd2
    complexed with pal, zn; mutant

Details for d1f1ba1

PDB Entry: 1f1b (more details), 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate
PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1f1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1ba1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d1f1ba1 are not available.

Timeline for d1f1ba1:

Domains from same chain:
(mouse over for more information)
d1f1ba2
Domains from other chains:
(mouse over for more information)
d1f1bb1, d1f1bb2, d1f1bc1, d1f1bc2, d1f1bd1, d1f1bd2