Lineage for d1f1bd2 (1f1b D:101-153)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
    Uniprot P00478
  8. Domain d1f1bd2: 1f1b D:101-153 [45270]
    Other proteins in same PDB: d1f1ba1, d1f1ba2, d1f1bb1, d1f1bc1, d1f1bc2, d1f1bd1
    complexed with pal, zn; mutant

Details for d1f1bd2

PDB Entry: 1f1b (more details), 2.3 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1f1bd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1bd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1f1bd2 are not available.

Timeline for d1f1bd2:

Domains from same chain:
(mouse over for more information)
d1f1bd1
Domains from other chains:
(mouse over for more information)
d1f1ba1, d1f1ba2, d1f1bb1, d1f1bb2, d1f1bc1, d1f1bc2