![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families) ![]() automatically mapped to Pfam PF05191 |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species) |
![]() | Species Maize (Zea mays) [TaxId:4577] [57782] (1 PDB entry) |
![]() | Domain d1zakb2: 1zak B:128-158 [45203] Other proteins in same PDB: d1zaka1, d1zakb1 contains a rudiment "zinc-finger" subdomain complexed with ap5 |
PDB Entry: 1zak (more details), 3.5 Å
SCOPe Domain Sequences for d1zakb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zakb2 g.41.2.1 (B:128-158) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Maize (Zea mays) [TaxId: 4577]} grrldpvtgkiyhlkysppeneeiasrltqr
Timeline for d1zakb2: