Lineage for d1zakb1 (1zak B:3-127,B:159-222)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865734Species Maize (Zea mays) [TaxId:4577] [52561] (1 PDB entry)
  8. 2865736Domain d1zakb1: 1zak B:3-127,B:159-222 [31914]
    Other proteins in same PDB: d1zaka2, d1zakb2
    contains a rudiment "zinc-finger" subdomain, residue 128-158
    complexed with ap5

Details for d1zakb1

PDB Entry: 1zak (more details), 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)
PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1zakb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zakb1 c.37.1.1 (B:3-127,B:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}
adplkvmisgapasgkgtqceliktkyqlahisagdllraeiaagsengkrakefmekgq
lvpdeivvnmvkerlrqpdaqengwlldgyprsysqamaletleirpdtfilldvpdell
vervvXfddteekvklrletyyqniesllstyeniivkvqgdatvdavfakidellgsil
ekknemvsst

SCOPe Domain Coordinates for d1zakb1:

Click to download the PDB-style file with coordinates for d1zakb1.
(The format of our PDB-style files is described here.)

Timeline for d1zakb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zakb2