Lineage for d1hcpa_ (1hcp A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2640327Protein Estrogen receptor DNA-binding domain [57728] (1 species)
  7. 2640328Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries)
    identical sequences
  8. 2640333Domain d1hcpa_: 1hcp A: [45121]
    complexed with zn

Details for d1hcpa_

PDB Entry: 1hcp (more details)

PDB Description: dna recognition by the oestrogen receptor: from solution to the crystal
PDB Compounds: (A:) human/chicken estrogen receptor

SCOPe Domain Sequences for d1hcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcpa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]}
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmkg

SCOPe Domain Coordinates for d1hcpa_:

Click to download the PDB-style file with coordinates for d1hcpa_.
(The format of our PDB-style files is described here.)

Timeline for d1hcpa_: