Lineage for d1hcp__ (1hcp -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Estrogen receptor DNA-binding domain [57728] (1 species) Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries) 
Domain d1hcp__: 1hcp - [45121]
Details for d1hcp__
PDB Entry: 1hcp (more details)
PDB Description: dna recognition by the oestrogen receptor: from solution to the crystal
SCOP Domain Sequences for d1hcp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcp__ g.39.1.2 (-) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus)}
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmkg
SCOP Domain Coordinates for d1hcp__:
Click to download the PDB-style file with coordinates for d1hcp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hcp__:
- d1hcp__ appears in SCOP 1.57
- d1hcp__ appears in the current release, SCOPe 2.08, called d1hcpa_
View in 3D