SCOPe 2.08: Domain d1hcpa_: 1hcp A:

Lineage for d1hcpa_ (1hcp A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Estrogen receptor DNA-binding domain [57728] (1 species)

7. Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries)
   identical sequences

8. Domain d1hcpa_: 1hcp A: [45121]
   complexed with zn

Details for d1hcpa_

PDB Entry: 1hcp

PDB Description: dna recognition by the oestrogen receptor: from solution to the crystal

PDB Compounds: (A:) human/chicken estrogen receptor

SCOPe Domain Sequences for d1hcpa_:

Sequence; same for both SEQRES and ATOM records:

>d1hcpa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]}
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmkg

Timeline for d1hcpa_:

• d1hcpa_ first appeared (with stable ids) in SCOP 1.55, called d1hcp__
  
• d1hcpa_ appears in SCOPe 2.07