PDB entry 1hcp

View 1hcp on RCSB PDB site
Description: DNA recognition by the oestrogen receptor: from solution to the crystal
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-11-23, released 1995-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human/chicken estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hcpa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hcpA (A:)
    mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
    acrlrkcyevgmmkgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcpA (A:)
    mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
    acrlrkcyevgmmkg