Lineage for d1yuja_ (1yuj A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704720Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1704721Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1704722Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1704744Protein GAGA factor [57695] (1 species)
  7. 1704745Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57696] (2 PDB entries)
  8. 1704746Domain d1yuja_: 1yuj A: [45072]
    protein/DNA complex; complexed with zn

Details for d1yuja_

PDB Entry: 1yuj (more details)

PDB Description: solution nmr structure of the gaga factor/dna complex, 50 structures
PDB Compounds: (A:) gaga-factor

SCOPe Domain Sequences for d1yuja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuja_ g.37.1.1 (A:) GAGA factor {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkakrakhppgtekprsrsqseqpatcpicyavirqsrnlrrhlelrhfakpgv

SCOPe Domain Coordinates for d1yuja_:

Click to download the PDB-style file with coordinates for d1yuja_.
(The format of our PDB-style files is described here.)

Timeline for d1yuja_: