PDB entry 1yuj

View 1yuj on RCSB PDB site
Description: solution nmr structure of the gaga factor/DNA complex, 50 structures
Class: DNA binding protein/DNA
Keywords: complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex
Deposited on 1996-12-31, released 1997-12-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gaga-factor
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08605 (0-53)
  Domains in SCOPe 2.04: d1yuja_
• Chain 'B':
  Compound: DNA (5'-d(*gp*cp*cp*gp*ap*gp*ap*gp*tp*ap*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*gp*tp*ap*cp*tp*cp*tp*cp*gp*gp*c)-3')
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yujA (A:)
  pkakrakhppgtekprsrsqseqpatcpicyavirqsrnlrrhlelrhfakpgv
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.