Lineage for d1yuja_ (1yuj A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41228Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 41229Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 41230Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins)
  6. 41252Protein GAGA factor [57695] (1 species)
  7. 41253Species Drosophila melanogaster [TaxId:7227] [57696] (2 PDB entries)
  8. 41254Domain d1yuja_: 1yuj A: [45072]

Details for d1yuja_

PDB Entry: 1yuj (more details)

PDB Description: solution nmr structure of the gaga factor/dna complex, 50 structures

SCOP Domain Sequences for d1yuja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster}
pkakrakhppgtekprsrsqseqpatcpicyavirqsrnlrrhlelrhfakpgv

SCOP Domain Coordinates for d1yuja_:

Click to download the PDB-style file with coordinates for d1yuja_.
(The format of our PDB-style files is described here.)

Timeline for d1yuja_: