SCOPe 2.03: Domain d1yuja_: 1yuj A:

Lineage for d1yuja_ (1yuj A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein GAGA factor [57695] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57696] (2 PDB entries)

8. Domain d1yuja_: 1yuj A: [45072]
   protein/DNA complex; complexed with zn

Details for d1yuja_

PDB Entry: 1yuj

PDB Description: solution nmr structure of the gaga factor/dna complex, 50 structures

PDB Compounds: (A:) gaga-factor

SCOPe Domain Sequences for d1yuja_:

Sequence; same for both SEQRES and ATOM records:

>d1yuja_ g.37.1.1 (A:) GAGA factor {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pkakrakhppgtekprsrsqseqpatcpicyavirqsrnlrrhlelrhfakpgv

Timeline for d1yuja_:

• d1yuja_ first appeared (with stable ids) in SCOP 1.55
  
• d1yuja_ appears in SCOPe 2.02
  
• d1yuja_ appears in SCOPe 2.04
  
• d1yuja_ appears in the current release, SCOPe 2.08