Lineage for d4znf__ (4znf -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41228Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 41229Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 41230Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins)
  6. 41239Protein Enhancer binding protein [57685] (1 species)
  7. 41240Species Human (Homo sapiens) [TaxId:9606] [57686] (3 PDB entries)
  8. 41243Domain d4znf__: 4znf - [45048]

Details for d4znf__

PDB Entry: 4znf (more details)

PDB Description: high-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution

SCOP Domain Sequences for d4znf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4znf__ g.37.1.1 (-) Enhancer binding protein {Human (Homo sapiens)}
rpyhcsycnfsfktkgnltkhmkskahskk

SCOP Domain Coordinates for d4znf__:

Click to download the PDB-style file with coordinates for d4znf__.
(The format of our PDB-style files is described here.)

Timeline for d4znf__: