PDB entry 4znf

View 4znf on RCSB PDB site
Description: high-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution
Deposited on 1990-07-09, released 1992-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-01-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4znf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4znf_ (-)
    rpyhcsycnfsfktkgnltkhmkskahskk